General Information

  • ID:  hor003910
  • Uniprot ID:  P01197
  • Protein name:  Corticotropin-like intermediary peptide
  • Gene name:  pomc
  • Organism:  Squalus acanthias (Spiny dogfish)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Squalus (genus), Squalidae (family), Squaliformes (order), Squalomorphii, Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PIKVYPNSFEDESVENMGPEL
  • Length:  21
  • Propeptide:  SYSMEHFRWGKPMGRKRRPIKVYPNSFEDESVENMGPEL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Precursor protein for pituitary hormones that regulate stress and environmental adaptation.; [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01197-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003910_AF2.pdbhor003910_ESM.pdb

Physical Information

Mass: 275153 Formula: C106H160N24O37S
Absent amino acids: ACHQRTW Common amino acids: E
pI: 3.67 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 5
Hydrophobicity: -71.9 Boman Index: -3754
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 64.76
Instability Index: 2991.43 Extinction Coefficient cystines: 1490
Absorbance 280nm: 74.5

Literature

  • PubMed ID:  4375977
  • Title:  The isolation and amino acid sequence of an adrenocorticotrophin from the pars distalis and a corticotrophin-like intermediate-lobe peptide from the neurointermediate lobe of the pituitary of the dogfish Squalus acanthias.